PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009106294.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 804aa    MW: 89755.7 Da    PI: 6.2747
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009106294.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.3e-29542593152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_009106294.1 542 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 593
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052530613IPR003035RWP-RK domain
PfamPF020421.2E-25545593IPR003035RWP-RK domain
SuperFamilySSF542771.89E-22696792No hitNo description
PROSITE profilePS5174529.203706789IPR000270PB1 domain
SMARTSM006661.8E-24706789IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-19707786No hitNo description
PfamPF005641.6E-17707787IPR000270PB1 domain
CDDcd064072.69E-36707783No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    Send to blast
MNNNYHLPMD PAMDSSFMDG LLLDGCWLET TTTDASEFPN FSPSTSLAPF DPSSFMWSPQ  60
QDNTAAISSS TTLSHMYGQG FAERSSLEDL STLNRRFWIG PSGGGHGSSV MERLVQAVKH  120
IKDFTSERGD SLIQLWVPVD RGGKRVLTTK EQPFSHDPMS QRLAHYREIS ENYQFSAEQE  180
DSSSKDLVGL PGRVFLGQVP EWTPDVRFFK NEEYPRVQHA QDCDVRGTLA IPVFEQGSKT  240
CLGVIEVVMT TQMVKLSPEL DSICRALQAV DLRSTEVPVS PSLKGPDFSY QAALPEIRNL  300
LRCACETHKL PLAQTWMSCL KQSKTGCRHN DHNYIHCVST IDDACYVGDP TVRDFHEACS  360
EHHLLKGQGV VGEAFLTNGP CFSSDVSSYK KSEYPLSHHA TMFGLHGTVA IRLRCIHTGS  420
ADFVLEFFLP KDCRDIEEQR RMLNALSTIM AHVPRSLRTV TEKELEEEGD QMVSEVETLP  480
KIEETCEVHE SSSNPQHVGL AVDGEIGFDY GKGVSVVNEN STFSSAGGGG SSRVTEKKKT  540
KAEKNITLDV LRQYFAGSLK DAAKSIGVCP TTLKRICRQH GIQRWPSRKI KKVGHSLQKI  600
QRVIDSVQGV SGHHLPIGSF YANFPNLASS QEQQSKQTTF LPSSSHSQPA KSSSPGSSCS  660
HTSSCSSETQ ANKEDPMNKA REDTRAIKQT QTTQLSPSTS SQDDDFLRVK VSYEEEKIRF  720
RMRNSRRLKD LLWEIAKRFS IEDVSRYDLK YLDEDNEWVL LRCDDDVEEC VDVCRSFPGE  780
TIKLLLQLSS QHLQERSSVS GSLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106294.10.0PREDICTED: protein NLP5 isoform X1
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLM4DGY20.0M4DGY2_BRARP; Uncharacterized protein
STRINGBra015758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein